PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family YABBY
Protein Properties Length: 218aa    MW: 24280.6 Da    PI: 7.9362
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093672.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY238.12e-73121802170
           YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsv 96 
                     d+   seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++      a + hl++s+  + +++l  e  n + n  ++++++t+ 
  XP_010093672.1  12 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLGHSFFTPSHHNLLEEIPNPTPNFLMNQTNMTDF 106
                     577899******************************************999999999999*********************************** PP

           YABBY  97 sseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     ++      +d+e++r+p ++rPPekrqrvPsaynrfik+eiqrik+ nPdishreafsaaaknWahfP+ihfgl
  XP_010093672.1 107 AVPPRGVAHDHELSRPPVINRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHFPHIHFGL 180
                     ****************99******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.6E-6916180IPR006780YABBY protein
SuperFamilySSF470951.01E-7123173IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.7E-4128174IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSSSSASTLS LDHLPPSEQL CYVHCNICDT VLAVSVPCTS LFKTVTVRCG HCTNLLPVNM  60
RGLLLPSANQ FHLGHSFFTP SHHNLLEEIP NPTPNFLMNQ TNMTDFAVPP RGVAHDHELS  120
RPPVINRPPE KRQRVPSAYN RFIKDEIQRI KSVNPDISHR EAFSAAAKNW AHFPHIHFGL  180
MPDQSANKKT NVRQEGEDVL MKDAGFFASA NHVGVAPY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093672.11e-163hypothetical protein L484_019011
SwissprotO221521e-80YAB1_ARATH; Axial regulator YABBY 1
TrEMBLW9QUG41e-163W9QUG4_9R
STRINGVIT_02s0154g00070.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.13e-81YABBY family protein